PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G19900.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CPP
Protein Properties Length: 383aa    MW: 42372.1 Da    PI: 8.0638
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G19900.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR43.84.9e-1483120340
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C Ckks+Clk+YC Cfa g +Cse+C C+ C+Nk 
  OPUNC05G19900.2  83 CKHCACKKSRCLKLYCPCFAGGGYCSEKCGCQPCFNKA 120
                      89**********************************85 PP

2TCR49.96.2e-16179215339
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      ++gCnCkks+ClkkYC+C+++g+ Cs  C+CedC+N 
  OPUNC05G19900.2 179 RRGCNCKKSSCLKKYCDCYQDGTGCSLFCRCEDCRNP 215
                      589********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.1E-1281122IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.01982217IPR005172CRC domain
PfamPF036385.7E-1084119IPR005172CRC domain
SMARTSM011141.7E-15177218IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-11180214IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MEATPISVKP PSPVAAAPPP APVQVPVPPP PPPPPPAAAM EPLAPQPVAV VVAEAEPCSM  60
NQLALTPTPK RQKVEESADG NGCKHCACKK SRCLKLYCPC FAGGGYCSEK CGCQPCFNKA  120
LYAETVQTTR KVLLSRQKRM SLKINRRSEA NAEAVVVFLT EFAGATEDAH HSSSSTPPRR  180
GCNCKKSSCL KKYCDCYQDG TGCSLFCRCE DCRNPFGKNE GIMAEESKRF LYTGADLDHS  240
EDEHDFIVER SPRLQSPISK ESSFQQTPPH VRGTNRDTHM FPQAISQWQP RSWHCSKRQS  300
NDRVIDDSGE YKNSNHDWQL SKQEDSYSIS RCVQILNGMA ELSQVEKSVA PDVFLQAGNR  360
EIFISLNGDV RALWLKRKIQ NLT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1080530.0AK108053.1 Oryza sativa Japonica Group cDNA clone:002-137-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640211.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X1
TrEMBLA0A0E0L4H80.0A0A0E0L4H8_ORYPU; Uncharacterized protein
STRINGORGLA05G0194300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101592937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.12e-42Tesmin/TSO1-like CXC domain-containing protein